SCOP 1.71: Domain d1eo2b_: 1eo2 B:

Lineage for d1eo2b_ (1eo2 B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (5 PDB entries)

8. Domain d1eo2b_: 1eo2 B: [22828]
   Other proteins in same PDB: d1eo2a_
   complexed with fe

Details for d1eo2b_

PDB Entry: 1eo2, 2.25 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase

SCOP Domain Sequences for d1eo2b_:

Sequence; same for both SEQRES and ATOM records:

>d1eo2b_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

Timeline for d1eo2b_:

• d1eo2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1eo2b_ appears in SCOP 1.69
  
• d1eo2b_ appears in SCOP 1.73
  
• d1eo2b_ appears in the current release, SCOPe 2.08