Lineage for d1eoab_ (1eoa B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552997Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 553342Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 553343Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 553456Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 553457Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (5 PDB entries)
  8. 553459Domain d1eoab_: 1eoa B: [22827]
    Other proteins in same PDB: d1eoaa_
    complexed with cyn, fe

Details for d1eoab_

PDB Entry: 1eoa (more details), 2.15 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with cyanide

SCOP Domain Sequences for d1eoab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eoab_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOP Domain Coordinates for d1eoab_:

Click to download the PDB-style file with coordinates for d1eoab_.
(The format of our PDB-style files is described here.)

Timeline for d1eoab_: