SCOP 1.71: Domain d1eoab_: 1eoa B:

Lineage for d1eoab_ (1eoa B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (5 PDB entries)

8. Domain d1eoab_: 1eoa B: [22827]
   Other proteins in same PDB: d1eoaa_
   complexed with cyn, fe

Details for d1eoab_

PDB Entry: 1eoa, 2.15 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with cyanide

SCOP Domain Sequences for d1eoab_:

Sequence; same for both SEQRES and ATOM records:

>d1eoab_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

Timeline for d1eoab_:

• d1eoab_ first appeared (with stable ids) in SCOP 1.55
  
• d1eoab_ appears in SCOP 1.69
  
• d1eoab_ appears in SCOP 1.73
  
• d1eoab_ appears in the current release, SCOPe 2.08