Lineage for d1eoab_ (1eoa B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) 
Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins) 
Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (5 PDB entries) 
Domain d1eoab_: 1eoa B: [22827]
Other proteins in same PDB: d1eoaa_
Details for d1eoab_
PDB Entry: 1eoa (more details), 2.15 Å
PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with cyanide
SCOP Domain Sequences for d1eoab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eoab_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt
SCOP Domain Coordinates for d1eoab_:
Click to download the PDB-style file with coordinates for d1eoab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eoab_:
- d1eoab_ appears in SCOP 1.57
- d1eoab_ appears in the current release, SCOPe 2.08
View in 3D
