Lineage for d4mlla_ (4mll A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450418Protein Class D beta-lactamase [56622] (4 species)
  7. 1450419Species Escherichia coli, OXA-1 [TaxId:562] [82837] (4 PDB entries)
  8. 1450420Domain d4mlla_: 4mll A: [228263]
    automated match to d4f7yd_
    complexed with 1s6, mpd, po4

Details for d4mlla_

PDB Entry: 4mll (more details), 1.37 Å

PDB Description: The 1.4 A structure of the class D beta-lactamase OXA-1 K70D complexed with oxacillin
PDB Compounds: (A:) beta-lactamase OXA-1

SCOPe Domain Sequences for d4mlla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlla_ e.3.1.1 (A:) Class D beta-lactamase {Escherichia coli, OXA-1 [TaxId: 562]}
tdistvasplfegtegcfllydastnaeiaqfnkakcatqmapdstfdialslmafdaei
idqktifkwdktpkgmeiwnsnhtpktwmqfsvvwvsqeitqkiglnkiknylkdfdygn
qdfsgdkernnglteawlesslkispeeqiqflrkiinhnlpvknsaientienmylqdl
dnstklygktgagftanrtlqngwfegfiisksghkyvfvsaltgnlgsnltssikakkn
aitilntlnl

SCOPe Domain Coordinates for d4mlla_:

Click to download the PDB-style file with coordinates for d4mlla_.
(The format of our PDB-style files is described here.)

Timeline for d4mlla_: