Lineage for d1eo9b_ (1eo9 B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 660205Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 660206Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 660362Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 660363Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (12 PDB entries)
  8. 660371Domain d1eo9b_: 1eo9 B: [22826]
    Other proteins in same PDB: d1eo9a_
    complexed with fe, so4

Details for d1eo9b_

PDB Entry: 1eo9 (more details), 2 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase at ph < 7.0
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain;

SCOP Domain Sequences for d1eo9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo9b_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOP Domain Coordinates for d1eo9b_:

Click to download the PDB-style file with coordinates for d1eo9b_.
(The format of our PDB-style files is described here.)

Timeline for d1eo9b_: