Lineage for d4mjmd_ (4mjm D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080705Species Bacillus anthracis [TaxId:198094] [228249] (8 PDB entries)
  8. 2080711Domain d4mjmd_: 4mjm D: [228250]
    Other proteins in same PDB: d4mjmb2, d4mjmc2
    automated match to d1eepa_
    complexed with edo

Details for d4mjmd_

PDB Entry: 4mjm (more details), 2.25 Å

PDB Description: crystal structure of the inosine 5'-monophosphate dehydrogenase, with a short internal deletion of cbs domain from bacillus anthracis str. ames
PDB Compounds: (D:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d4mjmd_:

Sequence, based on SEQRES records: (download)

>d4mjmd_ c.1.5.0 (D:) automated matches {Bacillus anthracis [TaxId: 198094]}
kfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadmaiama
rqgglgiihknmsieqqaeqvdkvkrsesggikdiekviefpnsakdkqgrllvgaavgv
tadamtridalvkasvdaivldtahghsqgvidkvkevrakypslniiagnvataeatka
lieaganvvkvgigpgsicttrvvagvgvpqltavydcatearkhgipviadggikysgd
mvkalaagahvvmlgsmfagvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqeg
nkklvpegiegrvpykgpladtvhqlvgglragmgycgaqdleflrenaqfirmsgagll
esh

Sequence, based on observed residues (ATOM records): (download)

>d4mjmd_ c.1.5.0 (D:) automated matches {Bacillus anthracis [TaxId: 198094]}
kfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadmaiama
rqgglgiihknmsieqqaeqvdkvkrsesikdiekviefpnsakdkqgrllvgaavgvta
damtridalvkasvdaivldtahghsqgvidkvkevrakypslniiagnvataeatkali
eaganvvkvgigpgsicttrvvagvgvpqltavydcatearkhgipviadggikysgdmv
kalaagahvvmlgsmfagvaespgeteigrqfkvygrvpykgpladtvhqlvgglragmg
ycgaqdleflrenaqfirmsgagllesh

SCOPe Domain Coordinates for d4mjmd_:

Click to download the PDB-style file with coordinates for d4mjmd_.
(The format of our PDB-style files is described here.)

Timeline for d4mjmd_: