Lineage for d3pcnr_ (3pcn R:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790808Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 790809Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 790969Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 790987Species Pseudomonas putida [TaxId:303] [49490] (21 PDB entries)
  8. 791095Domain d3pcnr_: 3pcn R: [22825]
    Other proteins in same PDB: d3pcna_, d3pcnb_, d3pcnc_, d3pcnd_, d3pcne_, d3pcnf_
    complexed with bme, dhy, fe

Details for d3pcnr_

PDB Entry: 3pcn (more details), 2.4 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3,4-dihydroxyphenylacetate
PDB Compounds: (R:) protocatechuate 3,4-dioxygenase

SCOP Domain Sequences for d3pcnr_:

Sequence, based on SEQRES records: (download)

>d3pcnr_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pcnr_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOP Domain Coordinates for d3pcnr_:

Click to download the PDB-style file with coordinates for d3pcnr_.
(The format of our PDB-style files is described here.)

Timeline for d3pcnr_: