Lineage for d4lhve1 (4lhv E:6-174)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867502Protein Rab8a [142293] (2 species)
  7. 2867503Species Human (Homo sapiens) [TaxId:9606] [254870] (14 PDB entries)
  8. 2867524Domain d4lhve1: 4lhv E:6-174 [228233]
    Other proteins in same PDB: d4lhva2, d4lhvb2, d4lhve2
    automated match to d3bc1a_
    complexed with gdp, mg

Details for d4lhve1

PDB Entry: 4lhv (more details), 1.95 Å

PDB Description: Crystal structure of Rab8 in its inactive GDP-bound form
PDB Compounds: (E:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d4lhve1:

Sequence, based on SEQRES records: (download)

>d4lhve1 c.37.1.8 (E:6-174) Rab8a {Human (Homo sapiens) [TaxId: 9606]}
dylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdta
gqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdv
ndkrqvskergeklaldygikfmetsakaninvenafftlardikakmd

Sequence, based on observed residues (ATOM records): (download)

>d4lhve1 c.37.1.8 (E:6-174) Rab8a {Human (Homo sapiens) [TaxId: 9606]}
dylfkllligdsgvgktcvlfrfsedadfkirtieldgkriklqiwdtayyrgamgimlv
yditneksfdnirnwirnieehasadvekmilgnkcdvndkrqvskergeklaldygikf
metsakaninvenafftlardikakmd

SCOPe Domain Coordinates for d4lhve1:

Click to download the PDB-style file with coordinates for d4lhve1.
(The format of our PDB-style files is described here.)

Timeline for d4lhve1: