Lineage for d4lacb_ (4lac B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738810Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 2738811Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 2738812Family a.268.1.1: PTPA-like [140985] (2 proteins)
    Pfam PF03095
  6. 2738831Protein automated matches [190724] (2 species)
    not a true protein
  7. 2738838Species Human (Homo sapiens) [TaxId:9606] [228230] (1 PDB entry)
  8. 2738839Domain d4lacb_: 4lac B: [228231]
    Other proteins in same PDB: d4lacc_
    automated match to d2g62a1
    complexed with ags, mes, mn, peg

Details for d4lacb_

PDB Entry: 4lac (more details), 2.82 Å

PDB Description: Crystal Structure of Protein Phosphatase 2A (PP2A) and PP2A phosphatase activator (PTPA) complex with ATPgammaS
PDB Compounds: (B:) Serine/threonine-protein phosphatase 2A activator

SCOPe Domain Sequences for d4lacb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lacb_ a.268.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklval
lntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylk
esvgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyr
mepagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfi
temktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpv
t

SCOPe Domain Coordinates for d4lacb_:

Click to download the PDB-style file with coordinates for d4lacb_.
(The format of our PDB-style files is described here.)

Timeline for d4lacb_: