SCOPe 2.06: Domain d4l3kb1: 4l3k B:1-74

Lineage for d4l3kb1 (4l3k B:1-74)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily)
   barrel, closed; n=6, S=8; a crossover loop topology

4. Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family)
   automatically mapped to Pfam PF02814

5. Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (2 proteins)

6. Protein automated matches [228222] (1 species)
   not a true protein

7. Species Sporosarcina pasteurii [TaxId:1474] [228223] (1 PDB entry)

8. Domain d4l3kb1: 4l3k B:1-74 [228224]
   Other proteins in same PDB: d4l3ka2, d4l3kb2
   automated match to d1eara1
   complexed with ni, zn

Details for d4l3kb1

PDB Entry: 4l3k, 1.88 Å

PDB Description: crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+

PDB Compounds: (B:) urease accessory protein uree

SCOPe Domain Sequences for d4l3kb1:

Sequence; same for both SEQRES and ATOM records:

>d4l3kb1 b.107.1.1 (B:1-74) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
mlitkivghiddyessdkkvdwlevewedlnkrilrketengtdiaiklensgtlrygdv
lyesddtliairtk

Timeline for d4l3kb1:

• d4l3kb1 first appeared in SCOPe 2.03
  
• d4l3kb1 appears in SCOPe 2.05
  
• d4l3kb1 appears in SCOPe 2.07
  
• d4l3kb1 appears in the current release, SCOPe 2.08