Lineage for d4kfqa_ (4kfq A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1390578Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1391181Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species)
  7. 1391182Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (14 PDB entries)
  8. 1391194Domain d4kfqa_: 4kfq A: [228215]
    automated match to d1pb7a_
    complexed with gol, kfq, so4

Details for d4kfqa_

PDB Entry: 4kfq (more details), 2.2 Å

PDB Description: crystal structure of the nmda receptor glun1 ligand binding domain in complex with 1-thioxo-1,2-dihydro-[1,2,4]triazolo[4,3-a]quinoxalin- 4(5h)-one
PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d4kfqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kfqa_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc
ygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmiva
pltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdi
yfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttge
lffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqecds

SCOPe Domain Coordinates for d4kfqa_:

Click to download the PDB-style file with coordinates for d4kfqa_.
(The format of our PDB-style files is described here.)

Timeline for d4kfqa_: