SCOPe 2.03: Domain d4kfqb_: 4kfq B:

Lineage for d4kfqb_ (4kfq B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (14 PDB entries)

8. Domain d4kfqb_: 4kfq B: [228214]
   automated match to d1pb7a_
   complexed with gol, kfq, so4

Details for d4kfqb_

PDB Entry: 4kfq, 2.2 Å

PDB Description: crystal structure of the nmda receptor glun1 ligand binding domain in complex with 1-thioxo-1,2-dihydro-[1,2,4]triazolo[4,3-a]quinoxalin- 4(5h)-one

PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d4kfqb_:

Sequence; same for both SEQRES and ATOM records:

>d4kfqb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqccy
gfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvr

Timeline for d4kfqb_:

• d4kfqb_ is new in SCOPe 2.03-stable
  
• d4kfqb_ appears in SCOPe 2.04
  
• d4kfqb_ appears in the current release, SCOPe 2.08