SCOPe 2.08: Domain d4jf5a_: 4jf5 A:

Lineage for d4jf5a_ (4jf5 A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (64 PDB entries)

8. Domain d4jf5a_: 4jf5 A: [228197]
   automated match to d4k0xa_
   complexed with edo, flc

Details for d4jf5a_

PDB Entry: 4jf5, 1.15 Å

PDB Description: Structure of OXA-23 at pH 4.1

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4jf5a_:

Sequence; same for both SEQRES and ATOM records:

>d4jf5a_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
ivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfkmlnaligle
nqktdineifkwkgekrsftawekdmtlgeamklsavpvyqelarrigldlmqkevkrig
fgnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesngy
kifgktgwamdikpqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkqln
ii

Timeline for d4jf5a_:

• d4jf5a_ first appeared in SCOPe 2.03
  
• d4jf5a_ appears in SCOPe 2.07