SCOPe 2.07: Domain d4hjga1: 4hjg A:1-107

Lineage for d4hjga1 (4hjg A:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4hjga1: 4hjg A:1-107 [228190]
   Other proteins in same PDB: d4hjga2, d4hjge_, d4hjgh1, d4hjgh2
   automated match to d1g9ml1

Details for d4hjga1

PDB Entry: 4hjg, 2 Å

PDB Description: Meditope-enabled trastuzumab

PDB Compounds: (A:) Trastuzumab light chain

SCOPe Domain Sequences for d4hjga1:

Sequence; same for both SEQRES and ATOM records:

>d4hjga1 b.1.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspillsasvgdrvtitcrasqdvntavawyqqrtngsprlliysasflysgvps
rfsgsrsgtdftltisslqpediadyycqqhyttpptfgagtkveik

Timeline for d4hjga1:

• d4hjga1 first appeared in SCOPe 2.03
  
• d4hjga1 appears in SCOPe 2.06
  
• d4hjga1 appears in the current release, SCOPe 2.08