Lineage for d4i0cd_ (4i0c D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1289964Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (22 PDB entries)
  8. 1289982Domain d4i0cd_: 4i0c D: [228187]
    Other proteins in same PDB: d4i0ca_, d4i0cb_
    automated match to d2x89a_
    complexed with cl, gol

Details for d4i0cd_

PDB Entry: 4i0c (more details), 1.95 Å

PDB Description: The structure of the camelid antibody cAbHuL5 in complex with human lysozyme
PDB Compounds: (D:) cAbHuL5 antibody

SCOPe Domain Sequences for d4i0cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i0cd_ b.1.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyad
svkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgt
qvtvssh

SCOPe Domain Coordinates for d4i0cd_:

Click to download the PDB-style file with coordinates for d4i0cd_.
(The format of our PDB-style files is described here.)

Timeline for d4i0cd_:

  • d4i0cd_ appears in periodic updates to SCOPe 2.03 starting on 2013-12-06
  • d4i0cd_ appears in SCOPe 2.04
  • d4i0cd_ appears in the current release, SCOPe 2.07, called d4i0cd1