SCOPe 2.05: Domain d4hkzh_: 4hkz H:

Lineage for d4hkzh_ (4hkz H:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein automated matches [191290] (4 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [228180] (3 PDB entries)

8. Domain d4hkzh_: 4hkz H: [228183]
   Other proteins in same PDB: d4hkza1, d4hkza2, d4hkze_
   automated match to d1h0ta_
   complexed with cl

Details for d4hkzh_

PDB Entry: 4hkz, 2.08 Å

PDB Description: trastuzumab fab complexed with protein l and protein a fragments

PDB Compounds: (H:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4hkzh_:

Sequence; same for both SEQRES and ATOM records:

>d4hkzh_ a.8.1.1 (H:) automated matches {Staphylococcus aureus [TaxId: 158878]}
gsynkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

Timeline for d4hkzh_:

• d4hkzh_ first appeared in SCOPe 2.03
  
• d4hkzh_ appears in SCOPe 2.04
  
• d4hkzh_ is called d4hkzh1 in SCOPe 2.06
  
• d4hkzh_ appears in the current release, SCOPe 2.08, called d4hkzh1