Lineage for d4hkzh_ (4hkz H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724803Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1724804Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1724805Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1724826Protein automated matches [191290] (4 species)
    not a true protein
  7. 1724856Species Staphylococcus aureus [TaxId:158878] [228180] (3 PDB entries)
  8. 1724859Domain d4hkzh_: 4hkz H: [228183]
    Other proteins in same PDB: d4hkza1, d4hkza2, d4hkze_
    automated match to d1h0ta_
    complexed with cl

Details for d4hkzh_

PDB Entry: 4hkz (more details), 2.08 Å

PDB Description: trastuzumab fab complexed with protein l and protein a fragments
PDB Compounds: (H:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4hkzh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hkzh_ a.8.1.1 (H:) automated matches {Staphylococcus aureus [TaxId: 158878]}
gsynkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

SCOPe Domain Coordinates for d4hkzh_:

Click to download the PDB-style file with coordinates for d4hkzh_.
(The format of our PDB-style files is described here.)

Timeline for d4hkzh_: