| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
| Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
| Protein automated matches [190067] (6 species) not a true protein |
| Species Finegoldia magna [TaxId:1260] [188811] (5 PDB entries) |
| Domain d4hkze_: 4hkz E: [228182] Other proteins in same PDB: d4hkza1, d4hkza2, d4hkzh_ automated match to d1ymhe_ complexed with cl |
PDB Entry: 4hkz (more details), 2.08 Å
SCOPe Domain Sequences for d4hkze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hkze_ d.15.7.1 (E:) automated matches {Finegoldia magna [TaxId: 1260]}
sevtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnik
fag
Timeline for d4hkze_: