Lineage for d4hkze1 (4hkz E:22-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934778Species Finegoldia magna [TaxId:1260] [188811] (8 PDB entries)
  8. 2934785Domain d4hkze1: 4hkz E:22-81 [228182]
    Other proteins in same PDB: d4hkza1, d4hkza2, d4hkzb_, d4hkze2, d4hkzh1, d4hkzh2
    automated match to d1ymhe_
    complexed with cl

Details for d4hkze1

PDB Entry: 4hkz (more details), 2.08 Å

PDB Description: trastuzumab fab complexed with protein l and protein a fragments
PDB Compounds: (E:) Protein L fragment

SCOPe Domain Sequences for d4hkze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hkze1 d.15.7.1 (E:22-81) automated matches {Finegoldia magna [TaxId: 1260]}
tikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnikfag

SCOPe Domain Coordinates for d4hkze1:

Click to download the PDB-style file with coordinates for d4hkze1.
(The format of our PDB-style files is described here.)

Timeline for d4hkze1: