SCOPe 2.03: Domain d4hjgh_: 4hjg H:

Lineage for d4hjgh_ (4hjg H:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein automated matches [191290] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [228180] (3 PDB entries)

8. Domain d4hjgh_: 4hjg H: [228181]
   Other proteins in same PDB: d4hjga1, d4hjga2, d4hjge_
   automated match to d1h0ta_

Details for d4hjgh_

PDB Entry: 4hjg, 2 Å

PDB Description: Meditope-enabled trastuzumab

PDB Compounds: (H:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4hjgh_:

Sequence; same for both SEQRES and ATOM records:

>d4hjgh_ a.8.1.1 (H:) automated matches {Staphylococcus aureus [TaxId: 158878]}
gsynkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

Timeline for d4hjgh_:

• d4hjgh_ is new in SCOPe 2.03-stable
  
• d4hjgh_ appears in SCOPe 2.04
  
• d4hjgh_ appears in the current release, SCOPe 2.08, called d4hjgh1