Lineage for d4hjge_ (4hjg E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934778Species Finegoldia magna [TaxId:1260] [188811] (8 PDB entries)
  8. 2934781Domain d4hjge_: 4hjg E: [228179]
    Other proteins in same PDB: d4hjga1, d4hjga2, d4hjgb_, d4hjgh1, d4hjgh2
    automated match to d1ymhe_

Details for d4hjge_

PDB Entry: 4hjg (more details), 2 Å

PDB Description: Meditope-enabled trastuzumab
PDB Compounds: (E:) Protein L fragment

SCOPe Domain Sequences for d4hjge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hjge_ d.15.7.1 (E:) automated matches {Finegoldia magna [TaxId: 1260]}
evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnikf
ag

SCOPe Domain Coordinates for d4hjge_:

Click to download the PDB-style file with coordinates for d4hjge_.
(The format of our PDB-style files is described here.)

Timeline for d4hjge_: