Lineage for d4c8xa_ (4c8x A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525251Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1525365Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 1525366Protein automated matches [191113] (6 species)
    not a true protein
  7. 1525390Species Clostridium thermocellum [TaxId:203119] [194259] (4 PDB entries)
  8. 1525394Domain d4c8xa_: 4c8x A: [228169]
    automated match to d4b9fb_
    mutant

Details for d4c8xa_

PDB Entry: 4c8x (more details), 2 Å

PDB Description: Crystal structure of carbohydrate-binding module CBM3b mutant (Y56S) from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum
PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d4c8xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c8xa_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]}
dvkvqylcentqtstqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficsytpi
gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
kafqdygkvtlykngelvwgtppg

SCOPe Domain Coordinates for d4c8xa_:

Click to download the PDB-style file with coordinates for d4c8xa_.
(The format of our PDB-style files is described here.)

Timeline for d4c8xa_: