![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (13 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:203119] [194259] (5 PDB entries) |
![]() | Domain d4c8xa_: 4c8x A: [228169] automated match to d4b9fb_ mutant |
PDB Entry: 4c8x (more details), 2 Å
SCOPe Domain Sequences for d4c8xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c8xa_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]} dvkvqylcentqtstqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficsytpi gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti kafqdygkvtlykngelvwgtppg
Timeline for d4c8xa_: