Lineage for d4c8xd_ (4c8x D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767350Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2767351Protein automated matches [191113] (13 species)
    not a true protein
  7. 2767414Species Clostridium thermocellum [TaxId:203119] [194259] (5 PDB entries)
  8. 2767421Domain d4c8xd_: 4c8x D: [228168]
    automated match to d4b9fb_
    mutant

Details for d4c8xd_

PDB Entry: 4c8x (more details), 2 Å

PDB Description: Crystal structure of carbohydrate-binding module CBM3b mutant (Y56S) from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum
PDB Compounds: (D:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d4c8xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c8xd_ b.2.2.0 (D:) automated matches {Clostridium thermocellum [TaxId: 203119]}
dvkvqylcentqtstqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficsytpi
gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
kafqdygkvtlykngelvwgtppg

SCOPe Domain Coordinates for d4c8xd_:

Click to download the PDB-style file with coordinates for d4c8xd_.
(The format of our PDB-style files is described here.)

Timeline for d4c8xd_: