Lineage for d4c6va1 (4c6v A:2-259)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525226Species Mycobacterium tuberculosis [TaxId:83332] [228163] (17 PDB entries)
  8. 2525279Domain d4c6va1: 4c6v A:2-259 [228166]
    automated match to d2gp6a1
    complexed with edo, k, tlg

Details for d4c6va1

PDB Entry: 4c6v (more details), 2.7 Å

PDB Description: Crystal structure of M. tuberculosis KasA in complex with TLM5 (Soak for 5 min)
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d4c6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c6va1 c.95.1.0 (A:2-259) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsacssgseaiaha
wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
agalmlieteehakarga

SCOPe Domain Coordinates for d4c6va1:

Click to download the PDB-style file with coordinates for d4c6va1.
(The format of our PDB-style files is described here.)

Timeline for d4c6va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c6va2