SCOPe 2.05: Domain d4bx6c_: 4bx6 C:

Lineage for d4bx6c_ (4bx6 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (34 PDB entries)

8. Domain d4bx6c_: 4bx6 C: [228159]
   automated match to d4jnja_
   complexed with mpd

Details for d4bx6c_

PDB Entry: 4bx6, 1.6 Å

PDB Description: trans-divalent streptavidin

PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d4bx6c_:

Sequence; same for both SEQRES and ATOM records:

>d4bx6c_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

Timeline for d4bx6c_:

• d4bx6c_ first appeared in SCOPe 2.03
  
• d4bx6c_ appears in SCOPe 2.04
  
• d4bx6c_ appears in SCOPe 2.06
  
• d4bx6c_ appears in the current release, SCOPe 2.08