SCOPe 2.04: Domain d3zp0e_: 3zp0 E:

Lineage for d3zp0e_ (3zp0 E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (23 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [187142] (16 PDB entries)

8. Domain d3zp0e_: 3zp0 E: [228155]
   Other proteins in same PDB: d3zp0f_
   automated match to d1rvxa_
   complexed with nag

Details for d3zp0e_

PDB Entry: 3zp0, 2.51 Å

PDB Description: influenza virus (vn1194) h5 ha with lsta

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d3zp0e_:

Sequence; same for both SEQRES and ATOM records:

>d3zp0e_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

Timeline for d3zp0e_:

• d3zp0e_ first appeared in SCOPe 2.03
  
• d3zp0e_ appears in SCOPe 2.05
  
• d3zp0e_ appears in the current release, SCOPe 2.08