Lineage for d3zpaf_ (3zpa F:)
- Root: SCOPe 2.08
Class h: Coiled coil proteins [57942] (7 folds) 
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
core: trimeric coiled coil
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) 
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) 
Protein Influenza hemagglutinin (stalk) [58066] (22 species)
trimer
Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [419797] (7 PDB entries) 
Domain d3zpaf_: 3zpa F: [228153]
Other proteins in same PDB: d3zpae_
automated match to d2ibxb1
complexed with nag; mutant
Details for d3zpaf_
PDB Entry: 3zpa (more details), 2.5 Å
PDB Description: influenza virus (vn1194) h5 i155f mutant ha
PDB Compounds: (F:) HemagglutininSCOPe Domain Sequences for d3zpaf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zpaf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtyd
SCOPe Domain Coordinates for d3zpaf_:
Click to download the PDB-style file with coordinates for d3zpaf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zpaf_:
- d3zpaf_ first appeared in SCOPe 2.03
- d3zpaf_ appears in SCOPe 2.07
View in 3D
