| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
| Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
| Domain d3zp3f_: 3zp3 F: [228152] Other proteins in same PDB: d3zp3e_ automated match to d2ibxb1 complexed with gal, nag, sia; mutant |
PDB Entry: 3zp3 (more details), 2.65 Å
SCOPe Domain Sequences for d3zp3f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zp3f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtyd
Timeline for d3zp3f_: