SCOPe 2.08: Domain d3zp3f_: 3zp3 F:

Lineage for d3zp3f_ (3zp3 F:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)

8. Domain d3zp3f_: 3zp3 F: [228152]
   Other proteins in same PDB: d3zp3e_
   automated match to d2ibxb1
   complexed with gal, nag, sia; mutant

Details for d3zp3f_

PDB Entry: 3zp3, 2.65 Å

PDB Description: influenza virus (vn1194) h5 ha a138v mutant with lstc

PDB Compounds: (F:) Haemagglutinin

SCOPe Domain Sequences for d3zp3f_:

Sequence; same for both SEQRES and ATOM records:

>d3zp3f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtyd

Timeline for d3zp3f_:

• d3zp3f_ first appeared in SCOPe 2.03
  
• d3zp3f_ appears in SCOPe 2.07