![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (24 species) not a true protein |
![]() | Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [228150] (10 PDB entries) |
![]() | Domain d3zpae_: 3zpa E: [228151] Other proteins in same PDB: d3zpaf_ automated match to d1rvxa_ complexed with nag; mutant |
PDB Entry: 3zpa (more details), 2.5 Å
SCOPe Domain Sequences for d3zpae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zpae_ b.19.1.2 (E:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]} dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssvcpyqgkssffrnvvwlfkknstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d3zpae_: