Lineage for d3zpae_ (3zpa E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776109Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [228148] (4 PDB entries)
  8. 2776111Domain d3zpae_: 3zpa E: [228151]
    Other proteins in same PDB: d3zpaf_
    automated match to d1rvxa_
    complexed with nag; mutant

Details for d3zpae_

PDB Entry: 3zpa (more details), 2.5 Å

PDB Description: influenza virus (vn1194) h5 i155f mutant ha
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d3zpae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zpae_ b.19.1.2 (E:) automated matches {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssvcpyqgkssffrnvvwlfkknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3zpae_:

Click to download the PDB-style file with coordinates for d3zpae_.
(The format of our PDB-style files is described here.)

Timeline for d3zpae_: