Lineage for d3zp3e_ (3zp3 E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (25 species)
    not a true protein
  7. 2040860Species Influenza a virus [TaxId:644788] [228148] (1 PDB entry)
  8. 2040861Domain d3zp3e_: 3zp3 E: [228149]
    Other proteins in same PDB: d3zp3f_
    automated match to d1rvxa_
    complexed with nag; mutant

Details for d3zp3e_

PDB Entry: 3zp3 (more details), 2.65 Å

PDB Description: influenza virus (vn1194) h5 ha a138v mutant with lstc
PDB Compounds: (E:) Haemagglutinin

SCOPe Domain Sequences for d3zp3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zp3e_ b.19.1.2 (E:) automated matches {Influenza a virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssvcpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3zp3e_:

Click to download the PDB-style file with coordinates for d3zp3e_.
(The format of our PDB-style files is described here.)

Timeline for d3zp3e_: