Lineage for d3zp6f_ (3zp6 F:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267202Domain d3zp6f_: 3zp6 F: [228146]
    Other proteins in same PDB: d3zp6e_
    automated match to d2ibxb1
    complexed with nag; mutant

Details for d3zp6f_

PDB Entry: 3zp6 (more details), 2.6 Å

PDB Description: influenza virus (vn1194) h5 e190d mutant ha with lstc
PDB Compounds: (F:) Haemagglutinin

SCOPe Domain Sequences for d3zp6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zp6f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtyd

SCOPe Domain Coordinates for d3zp6f_:

Click to download the PDB-style file with coordinates for d3zp6f_.
(The format of our PDB-style files is described here.)

Timeline for d3zp6f_: