![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (19 species) not a true protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [187142] (19 PDB entries) |
![]() | Domain d3zp6e_: 3zp6 E: [228143] Other proteins in same PDB: d3zp6f_ automated match to d1rvxa_ complexed with nag; mutant |
PDB Entry: 3zp6 (more details), 2.6 Å
SCOPe Domain Sequences for d3zp6e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zp6e_ b.19.1.2 (E:) automated matches {Influenza A virus, different strains [TaxId: 11320]} dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaadqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d3zp6e_: