Lineage for d3zp2e_ (3zp2 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776136Species Influenza A virus, different strains [TaxId:11320] [187142] (19 PDB entries)
  8. 2776156Domain d3zp2e_: 3zp2 E: [228141]
    Other proteins in same PDB: d3zp2f_
    automated match to d1rvxa_
    complexed with nag; mutant

Details for d3zp2e_

PDB Entry: 3zp2 (more details), 2.5 Å

PDB Description: influenza virus (vn1194) h5 ha a138v mutant with lsta
PDB Compounds: (E:) Haemagglutinin

SCOPe Domain Sequences for d3zp2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zp2e_ b.19.1.2 (E:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssvcpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3zp2e_:

Click to download the PDB-style file with coordinates for d3zp2e_.
(The format of our PDB-style files is described here.)

Timeline for d3zp2e_: