Lineage for d3wc6a_ (3wc6 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497308Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2497375Protein Carboxypeptidase B [53193] (4 species)
  7. 2497385Species Pig (Sus scrofa) [TaxId:9823] [53194] (18 PDB entries)
  8. 2497391Domain d3wc6a_: 3wc6 A: [228135]
    automated match to d1z5ra1
    complexed with act, zn

Details for d3wc6a_

PDB Entry: 3wc6 (more details), 1.65 Å

PDB Description: carboxypeptidase b in complex with 2nd zinc
PDB Compounds: (A:) carboxypeptidase b

SCOPe Domain Sequences for d3wc6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wc6a_ c.56.5.1 (A:) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

SCOPe Domain Coordinates for d3wc6a_:

Click to download the PDB-style file with coordinates for d3wc6a_.
(The format of our PDB-style files is described here.)

Timeline for d3wc6a_: