SCOPe 2.08: Domain d3w1ca1: 3w1c A:2-231

Lineage for d3w1ca1 (3w1c A:2-231)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d3w1ca1: 3w1c A:2-231 [228132]
   Other proteins in same PDB: d3w1ca2
   automated match to d3st2a_

Details for d3w1ca1

PDB Entry: 3w1c, 1.3 Å

PDB Description: Structure of a pressure sensitive YFP variant YFP-G1

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3w1ca1:

Sequence; same for both SEQRES and ATOM records:

>d3w1ca1 d.22.1.1 (A:2-231) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgyglqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleyngynshnvyimadkqkngikvnfkirhniedgsvqlad
hyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit

Timeline for d3w1ca1:

• d3w1ca1 first appeared in SCOPe 2.03, called d3w1ca_
  
• d3w1ca1 appears in SCOPe 2.07