Lineage for d3pclr_ (3pcl R:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2042612Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2042613Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2042822Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2042837Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2042978Domain d3pclr_: 3pcl R: [22813]
    Other proteins in same PDB: d3pcla_, d3pclb_, d3pclc_, d3pcld_, d3pcle_, d3pclf_
    complexed with cyn, fe, ino

Details for d3pclr_

PDB Entry: 3pcl (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 2-hydroxyisonicotinic acid n-oxide and cyanide
PDB Compounds: (R:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pclr_:

Sequence, based on SEQRES records: (download)

>d3pclr_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pclr_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d3pclr_:

Click to download the PDB-style file with coordinates for d3pclr_.
(The format of our PDB-style files is described here.)

Timeline for d3pclr_: