Lineage for d4mqca_ (4mqc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299707Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2299840Species Human (Homo sapiens) [TaxId:9606] [46487] (287 PDB entries)
    Uniprot P69905 P01922 P01934 P01935
  8. 2300192Domain d4mqca_: 4mqc A: [228128]
    Other proteins in same PDB: d4mqcb_
    automated match to d1irda_
    complexed with cmo, hem

Details for d4mqca_

PDB Entry: 4mqc (more details), 2.2 Å

PDB Description: Carbonmonoxy Structure of Hemoglobin Evans alphaV62Mbetawt
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d4mqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqca_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kmadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOPe Domain Coordinates for d4mqca_:

Click to download the PDB-style file with coordinates for d4mqca_.
(The format of our PDB-style files is described here.)

Timeline for d4mqca_: