Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (34 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [228125] (2 PDB entries) |
Domain d4muza1: 4muz A:21-229 [228126] Other proteins in same PDB: d4muza2, d4muzb2 automated match to d3f4wa_ complexed with bmp, gol |
PDB Entry: 4muz (more details), 1.39 Å
SCOPe Domain Sequences for d4muza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4muza1 c.1.2.0 (A:21-229) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mkqlilaldvmdgekameiakkvaehvdrikvnyplvlsagvgimkrlseikpviadfki advpytssliariafensaesvivhgfvgsdtlrevcrvaeefggkvyavtelsspggee fmsavslkivekakeagchgliapstrierlreirkaagdmeilcpgigaqkgsieavky adgiivgrgiyasgnpaeearklrrvlki
Timeline for d4muza1: