SCOPe 2.05: Domain d4muza_: 4muz A:

Lineage for d4muza_ (4muz A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (26 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [228125] (2 PDB entries)

8. Domain d4muza_: 4muz A: [228126]
   automated match to d3f4wa_
   complexed with bmp, gol

Details for d4muza_

PDB Entry: 4muz, 1.39 Å

PDB Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from Archaeoglobus fulgidus complexed with inhibitor BMP

PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4muza_:

Sequence; same for both SEQRES and ATOM records:

>d4muza_ c.1.2.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
gshmkqlilaldvmdgekameiakkvaehvdrikvnyplvlsagvgimkrlseikpviad
fkiadvpytssliariafensaesvivhgfvgsdtlrevcrvaeefggkvyavtelsspg
geefmsavslkivekakeagchgliapstrierlreirkaagdmeilcpgigaqkgsiea
vkyadgiivgrgiyasgnpaeearklrrvlki

Timeline for d4muza_:

• d4muza_ first appeared in SCOPe 2.03
  
• d4muza_ appears in SCOPe 2.04
  
• d4muza_ is called d4muza1 in SCOPe 2.06
  
• d4muza_ appears in the current release, SCOPe 2.08, called d4muza1