Lineage for d4mqjf_ (4mqj F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717990Species Human (Homo sapiens) [TaxId:9606] [188371] (5 PDB entries)
  8. 1717995Domain d4mqjf_: 4mqj F: [228117]
    Other proteins in same PDB: d4mqja_, d4mqjc_, d4mqje_, d4mqjg_
    automated match to d1irdb_
    complexed with cmo, hem, oxy

Details for d4mqjf_

PDB Entry: 4mqj (more details), 1.8 Å

PDB Description: structure of wild-type fetal human hemoglobin hbf
PDB Compounds: (F:) Hemoglobin subunit gamma-2

SCOPe Domain Sequences for d4mqjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqjf_ a.1.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtgvasalssryh

SCOPe Domain Coordinates for d4mqjf_:

Click to download the PDB-style file with coordinates for d4mqjf_.
(The format of our PDB-style files is described here.)

Timeline for d4mqjf_: