Lineage for d4mdsa_ (4mds A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1320275Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 protein domains)
  6. 1320332Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 1320353Species SARS coronavirus [TaxId:227859] [89349] (64 PDB entries)
  8. 1320362Domain d4mdsa_: 4mds A: [228110]
    automated match to d3tnta_
    complexed with 23h, dms

Details for d4mdsa_

PDB Entry: 4mds (more details), 1.6 Å

PDB Description: Discovery of N-(benzo[1,2,3]triazol-1-yl)-N-(benzyl)acetamido)phenyl) carboxamides as severe acute respiratory syndrome coronavirus (SARS-CoV) 3CLpro inhibitors: identification of ML300 and non-covalent nanomolar inhibitors with an induced-fit binding
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d4mdsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mdsa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sga

SCOPe Domain Coordinates for d4mdsa_:

Click to download the PDB-style file with coordinates for d4mdsa_.
(The format of our PDB-style files is described here.)

Timeline for d4mdsa_:

  • d4mdsa_ appears in periodic updates to SCOPe 2.03 starting on 2013-12-06
  • d4mdsa_ appears in SCOPe 2.04
  • d4mdsa_ appears in the current release, SCOPe 2.07, called d4mdsa1