Lineage for d4m89b_ (4m89 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1347798Protein automated matches [190085] (38 species)
    not a true protein
  7. 1347969Species Neisseria meningitidis [TaxId:272831] [228105] (3 PDB entries)
  8. 1347971Domain d4m89b_: 4m89 B: [228108]
    automated match to d3ek2a_
    complexed with nad, tcl

Details for d4m89b_

PDB Entry: 4m89 (more details), 1.9 Å

PDB Description: Crystal Structure of Enoyl-Acyl Carrier Protein Reductase (FabI) from Neisseria meningitidis in complex with NAD+ and Triclosan
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d4m89b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m89b_ c.2.1.2 (B:) automated matches {Neisseria meningitidis [TaxId: 272831]}
gflqgkkilitgmisersiaygiakacreqgaelaftyvvdkleervrkmaaeldselvf
rcdvasddeinqvfadlgkhwdgldglvhsigfapkealsgdfldsisreafntaheisa
yslpalakaarpmmrgrnsaivalsylgavraipnynvmgmakasleagirftaaclgke
gircngisagpiktlaasgiadfgkllghvaahnplrrnvtieevgntaafllsdlssgi
tgeityvdggysinals

SCOPe Domain Coordinates for d4m89b_:

Click to download the PDB-style file with coordinates for d4m89b_.
(The format of our PDB-style files is described here.)

Timeline for d4m89b_: