Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.4: Complement components [48251] (3 proteins) probably related to other families, but has no known enzymatic activity |
Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48253] (12 PDB entries) |
Domain d4m76a_: 4m76 A: [228103] Other proteins in same PDB: d4m76b_ automated match to d2goxa_ complexed with ni |
PDB Entry: 4m76 (more details), 2.8 Å
SCOPe Domain Sequences for d4m76a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m76a_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} amavdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikk gytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilek qkpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitk agdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynve atsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap
Timeline for d4m76a_: