![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [228101] (5 PDB entries) |
![]() | Domain d4m56a2: 4m56 A:483-561 [228102] Other proteins in same PDB: d4m56a1, d4m56b1 automated match to d1uoka1 complexed with glo, gol, so4 |
PDB Entry: 4m56 (more details), 2.3 Å
SCOPe Domain Sequences for d4m56a2:
Sequence, based on SEQRES records: (download)
>d4m56a2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]} gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqer adlksislkpyeavmgisi
>d4m56a2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]} gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqra dlksislkpyeavmgisi
Timeline for d4m56a2: