Lineage for d4lv8b_ (4lv8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111465Species Mouse (Mus musculus) [TaxId:10090] [186896] (14 PDB entries)
  8. 2111470Domain d4lv8b_: 4lv8 B: [228098]
    automated match to d1tq6a_
    complexed with adp, edo, gdp, mg

Details for d4lv8b_

PDB Entry: 4lv8 (more details), 1.72 Å

PDB Description: murine irga6 bound to toxoplasma rop5c, a pseudokinase gdi
PDB Compounds: (B:) Interferon-inducible GTPase 1

SCOPe Domain Sequences for d4lv8b_:

Sequence, based on SEQRES records: (download)

>d4lv8b_ c.37.1.8 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
nfppntylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnea
dgkpqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpi
ykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksm
kfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiqerlsryiqefcla
ngyllpknsflkeifylkyyfldmvtedaktllkeic

Sequence, based on observed residues (ATOM records): (download)

>d4lv8b_ c.37.1.8 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
nfppntylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnea
dgkpqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpi
ykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksm
kfyrtvfgvdetslqrlvdqveamikspavfkptdeetiqerlsryiqefclangyllpk
nsflkeifylkyyfldmvtedaktllkeic

SCOPe Domain Coordinates for d4lv8b_:

Click to download the PDB-style file with coordinates for d4lv8b_.
(The format of our PDB-style files is described here.)

Timeline for d4lv8b_: