Lineage for d4ln3e_ (4ln3 E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1306141Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1306142Protein automated matches [227017] (8 species)
    not a true protein
  7. 1306161Species Influenza a virus [TaxId:1332244] [228093] (9 PDB entries)
  8. 1306174Domain d4ln3e_: 4ln3 E: [228094]
    automated match to d1rvxa_
    complexed with nag

Details for d4ln3e_

PDB Entry: 4ln3 (more details), 2.65 Å

PDB Description: the crystal structure of hemagglutinin from a h7n9 influenza virus (a/shanghai/1/2013)
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4ln3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln3e_ b.19.1.0 (E:) automated matches {Influenza a virus [TaxId: 1332244]}
gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
vkqrslllatgmknvp

SCOPe Domain Coordinates for d4ln3e_:

Click to download the PDB-style file with coordinates for d4ln3e_.
(The format of our PDB-style files is described here.)

Timeline for d4ln3e_: