Lineage for d4lhua2 (4lhu A:184-277)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368648Domain d4lhua2: 4lhu A:184-277 [228092]
    Other proteins in same PDB: d4lhua1, d4lhub1, d4lhub2, d4lhug2
    automated match to d3hujc2
    complexed with bma, cl, jls, mg, nag

Details for d4lhua2

PDB Entry: 4lhu (more details), 2.87 Å

PDB Description: crystal structure of 9c2 tcr bound to cd1d
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d4lhua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhua2 b.1.1.0 (A:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d4lhua2:

Click to download the PDB-style file with coordinates for d4lhua2.
(The format of our PDB-style files is described here.)

Timeline for d4lhua2: