SCOPe 2.04: Domain d4lhua1: 4lhu A:6-183

Lineage for d4lhua1 (4lhu A:6-183)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (11 PDB entries)

8. Domain d4lhua1: 4lhu A:6-183 [228091]
   Other proteins in same PDB: d4lhua2, d4lhub_, d4lhud1, d4lhud2, d4lhug1, d4lhug2
   automated match to d3hujc1
   complexed with bma, cl, jls, mg, nag

Details for d4lhua1

PDB Entry: 4lhu, 2.87 Å

PDB Description: crystal structure of 9c2 tcr bound to cd1d

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d4lhua1:

Sequence; same for both SEQRES and ATOM records:

>d4lhua1 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Timeline for d4lhua1:

• d4lhua1 first appeared in SCOPe 2.03
  
• d4lhua1 appears in SCOPe 2.05
  
• d4lhua1 appears in the current release, SCOPe 2.08