Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (908 PDB entries) Uniprot P00698 |
Domain d4lfxa_: 4lfx A: [228090] automated match to d2vb1a_ complexed with au, cl, na |
PDB Entry: 4lfx (more details), 2.1 Å
SCOPe Domain Sequences for d4lfxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lfxa_ d.2.1.2 (A:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d4lfxa_: